PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00023614001
Common NameGSBRNA2T00023614001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NAC
Protein Properties Length: 557aa    MW: 62211.5 Da    PI: 4.2169
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00023614001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.74.7e-5391361128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          l+pGfrFhPtdeelv +yLk+kv +k+++l ++i+ +d+yk+ePwdLp k k+k+++ ewyfFs  dkky++g+++nrat++gyWk+tgk
  GSBRNA2T00023614001   9 LAPGFRFHPTDEELVRYYLKRKVCNKPFKL-DAISVTDVYKSEPWDLPdKsKLKSRDLEWYFFSMLDKKYNNGSKTNRATEKGYWKTTGK 97 
                          579***************************.99**************95347777888******************************** PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          d+e+ + ++++vg+kktLv++kgrap+ge+t+Wvmheyrl
  GSBRNA2T00023614001  98 DREIRN-GSRAVGMKKTLVYHKGRAPRGERTNWVMHEYRL 136
                          *****9.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-627159IPR003441NAC domain
PROSITE profilePS5100558.5229159IPR003441NAC domain
PfamPF023654.6E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MGRGSATSLA PGFRFHPTDE ELVRYYLKRK VCNKPFKLDA ISVTDVYKSE PWDLPDKSKL  60
KSRDLEWYFF SMLDKKYNNG SKTNRATEKG YWKTTGKDRE IRNGSRAVGM KKTLVYHKGR  120
APRGERTNWV MHEYRLTDEE LKRTGAPQDA YVLCRIFQKS GTGPKNGEQY GAPYLEEEWE  180
EDKMTFVPEQ EALSEGLGVD DDVYLDIDEF DEKPENLVVY DAIPVEPNYY HGESSNNVES  240
GNYSDSGNYI QQIDSGGCFE QPIETFEEDQ KPIIRDGSIQ PCSLFPNEQN DENVVNLQTS  300
NDNVFAAENC YSDIPIDTNY MPDESFIDPS NNLPLSDGLY LEGNDLGNAL PDDFDFEDYL  360
EFFDDEDAQN LTLDVSQLLG SEDALPDQEG SDQMPSSEDL EKNVAEGKEA VEKDESGEGS  420
SSKQDADVTD FDSASKYPFL KKASQMCGAT SSFASQFQTK DGRLHAGQSS GSVHVTAGII  480
RISNMNLAAD MGWSYDKNNN LNVVLSFGLV QRDDGMSSSV NKTGGVPATR AMLIFICLWV  540
LLLSVSFKIG TMVSAR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-46816516171NAC domain-containing protein 19
4dul_A5e-46816516171NAC domain-containing protein 19
1ut7_B5e-46816516171NO APICAL MERISTEM PROTEIN
1ut7_A5e-46816516171NO APICAL MERISTEM PROTEIN
1ut4_B5e-46816516171NO APICAL MERISTEM PROTEIN
1ut4_A5e-46816516171NO APICAL MERISTEM PROTEIN
3swp_D7e-46816519174NAC domain-containing protein 19
3swp_C7e-46816519174NAC domain-containing protein 19
3swp_B7e-46816519174NAC domain-containing protein 19
3swp_A7e-46816519174NAC domain-containing protein 19
3swm_D7e-46816519174NAC domain-containing protein 19
3swm_C7e-46816519174NAC domain-containing protein 19
3swm_B7e-46816519174NAC domain-containing protein 19
3swm_A7e-46816519174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.136880.0seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530790.0AK353079.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-20-K06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013628918.10.0PREDICTED: NAC domain-containing protein 78-like isoform X2
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLA0A078J3K90.0A0A078J3K9_BRANA; BnaC03g71220D protein
STRINGBra005804.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.10.0NAC domain containing protein 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]